Neutralization:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Activity Assay:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Injection:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Clinical Proteomics:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Bioprocessing:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.
Marker:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
Enzyme-linked Immunosorbent Assay:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
In Vitro:Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..
other:Article Title: TLR5 agonist entolimod reduces the adverse toxicity of TNF while preserving its antitumor effects
Article Snippet: The following amended Competing Interests Statement has been included in the cover letter: “My relationship with Cleveland BioLabs, Inc. (CBLI), the company that developed and holds the rights to entolimod, was limited to receiving entolimod for this study.
Article Title: Toll-like receptor-5 agonist, entolimod, suppresses metastasis and induces immunity by stimulating an NK-dendritic-CD8 + T-cell axis
Article Snippet: Conflict of interest statement: A.V.G. and L.G.B. are coinventors of entolimod and, along with C.M.B. and S.O.G., are paid consultants for Cleveland Biolabs, a biotech company that holds the license for clinical use of entolimod and runs its development.
Adjuvant:Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.
Article Title: Fusion of Bacterial Flagellin to a Dendritic Cell-Targeting αCD40 Antibody Construct Coupled With Viral or Leukemia-Specific Antigens Enhances Dendritic Cell Maturation and Activates Peptide-Responsive T Cells
Article Snippet: .. More recently, entolimod is investigated as a vaccine adjuvant by its developing company Cleveland BioLabs. ..
Article Title: Toll-like receptors: the swiss army knife of immunity and vaccine development
Article Snippet: , Chronic fatigue syndrome (CFS), hepatitis and HPV , Adjuvant , Ampligen , — , —. .. TLR5 , myocardial ischemia/ reperfusion injury , Adjuvant , CBLB502 (synthetic flagellin) , Entolimod (Cleveland BioLabs) , . .. , Influenza , Adjuvant , Influenza antigen, M2e linked to Salmonella typhimurium flagellin. , VAX102 (VaxInnate) , .
Selection:Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.
Generated:Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.
Vaccines:Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.
Purification:Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.
Produced:Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.
Sequencing:Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.
|