Review




Structured Review

Cleveland Biolabs entolimod protectan cblb502
Entolimod Protectan Cblb502, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/cblb502/pmc12154233-28-0-1
Average 90 stars, based on 1 article reviews
entolimod protectan cblb502 - by Bioz Stars, 2026-09
90/100 stars

Images

Related Articles

Neutralization:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Activity Assay:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Injection:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Clinical Proteomics:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Bioprocessing:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.

Marker:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

Enzyme-linked Immunosorbent Assay:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

In Vitro:

Article Title: A deimmunized and pharmacologically optimized Toll-like receptor 5 agonist for therapeutic applications
Article Snippet: .. Human serum samples from 45 anonymous entolimod-naïve donors, selected for high entolimod neutralization activity (Bioreclamation IVT) Serum samples from patients injected with entolimod in clinical trials (Cleveland BioLabs, Inc.) Entolimod-reactive mouse monoclonal antibodies mAB4D11 and mAb11D04 (Cleveland BioLabs, Inc.) Normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies (obtained from clinical trial subjects prior to entolimod administration; Cleveland BioLabs, Inc.) Rabbit monoclonal Ab against NF-#B p65 (Cell Signaling, catalog #8242) Rat monoclonal Ab against macrophage marker F4/80 (ThermoFisher, catalog #MA1-91124) Fluorochrome-conjugated donkey Abs from Johnson ImmunoResearch (anti-rabbit Cy3 and anti-rat AlexaFluor 488) All entolimod-recognizing antibodies and antisera listed above were validated using ELISA and/or neutralization of in vitro signaling as described in the manuscript. ..

other:

Article Title: TLR5 agonist entolimod reduces the adverse toxicity of TNF while preserving its antitumor effects
Article Snippet: The following amended Competing Interests Statement has been included in the cover letter: “My relationship with Cleveland BioLabs, Inc. (CBLI), the company that developed and holds the rights to entolimod, was limited to receiving entolimod for this study.

Article Title: Toll-like receptor-5 agonist, entolimod, suppresses metastasis and induces immunity by stimulating an NK-dendritic-CD8 + T-cell axis
Article Snippet: Conflict of interest statement: A.V.G. and L.G.B. are coinventors of entolimod and, along with C.M.B. and S.O.G., are paid consultants for Cleveland Biolabs, a biotech company that holds the license for clinical use of entolimod and runs its development.

Adjuvant:

Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.

Article Title: Fusion of Bacterial Flagellin to a Dendritic Cell-Targeting αCD40 Antibody Construct Coupled With Viral or Leukemia-Specific Antigens Enhances Dendritic Cell Maturation and Activates Peptide-Responsive T Cells
Article Snippet: .. More recently, entolimod is investigated as a vaccine adjuvant by its developing company Cleveland BioLabs. ..

Article Title: Toll-like receptors: the swiss army knife of immunity and vaccine development
Article Snippet: , Chronic fatigue syndrome (CFS), hepatitis and HPV , Adjuvant , Ampligen , — , —. .. TLR5 , myocardial ischemia/ reperfusion injury , Adjuvant , CBLB502 (synthetic flagellin) , Entolimod (Cleveland BioLabs) , . .. , Influenza , Adjuvant , Influenza antigen, M2e linked to Salmonella typhimurium flagellin. , VAX102 (VaxInnate) , .

Selection:

Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.

Generated:

Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.

Vaccines:

Article Title: Current status of immunotherapies for addiction.
Article Snippet: The treatment of substance use disorders has always been challenging because multiple neurotransmitters mediate addiction.. However, with smoking being the leading cause of preventable death and the recent opioid epidemic in the United States, the search for novel solutions becomesmore imperative.. In this review, we discuss the use of antibodies to treat addictions and highlight areas of success and areas that require improvement, using examples from cocaine, nicotine, and opioid vaccines.

Purification:

Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.

Produced:

Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.

Sequencing:

Article Title: Method for producing TLR5 agonist protein
Article Snippet: .. To produce the TLR5 agonist protein by bioprocessing with use of microorganisms, consideration should be given to the separation and purification of the ‘produced TLR5 agonist protein.’ Due to such need, Cleveland Biolabs company produced the entolimod by adding 34 amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPM (SEQ ID NO: 9)) including the 6-histidine tag and the enterokinase recognition sequence for the purification and the cleavage to the D0 domain and the D1 domain, which directly bind to TLR5, among flagellin proteins of Salmonella enterica. .. However, the above 34 amino acid sequences bound to the fusion partner are preferably removed because of the possibility of induction of the immune response and inhibition of binding with TLR5.



Similar Products

90
Cleveland Biolabs entolimod protectan cblb502
Entolimod Protectan Cblb502, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/cblb502/pmc12154233-28-0-1
Average 90 stars, based on 1 article reviews
entolimod protectan cblb502 - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
Cleveland Biolabs entolimod (cblb502)
Entolimod (Cblb502), supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/cblb502/pm38630304-32-16-20
Average 90 stars, based on 1 article reviews
entolimod (cblb502) - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

86
InvivoGen recombinant flagellin protein derivative cblb502
Recombinant Flagellin Protein Derivative Cblb502, supplied by InvivoGen, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/pmc10768658-26-37-42
Average 86 stars, based on 1 article reviews
recombinant flagellin protein derivative cblb502 - by Bioz Stars, 2026-09
86/100 stars
  Buy from Supplier

90
Cleveland Biolabs entolimod
Entolimod, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/entolimod/pm33065293-211-4-47
Average 90 stars, based on 1 article reviews
entolimod - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
Cleveland Biolabs tlr5 agonist entolimod cblb502
Experimental layouts to determine the role of Nϕ in the A radioprotective and E radiomitigative effects of <t>entolimod</t> in BALB/c mice. Survival by Kaplan–Meier curves in mice treated with entolimod in the presence (rat IgG) or absence (α-Ly-6G) of Nϕ in the B radioprotective and F radiomitigative schemes. P -values were determined by Log-rank test. Measurement of total HPPs and granulocyte/macrophage (G/M) progenitors in BM by MethoCult in the C radioprotective ( n = 4–5 mice /group) and G radiomitigative ( n = 3–10 mice/group) schemes. Total HPPs were measured +1 h post-TBI for radioprotection and for radiomitigation, both total HPPs and G/M progenitors +3d post-treatment with vehicle or entolimod. D Absolute number of stem cell populations in BM by flow cytometry in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ on day 8 post-TBI in the radioprotection scheme ( n = 3–5 mice/group). Stem cell populations were defined as follows: HSC (Lineage − Flt3 − c-kit + Sca-1 + ), MMP (Lineage − Flt3 + c-kit + Sca-1 + ), CLP (Lineage − Flt3 − IL-7R + c-kit + Sca-1 + ), Myeloid (Lineage − Flt3 − IL-7R − c-kit − Sca-1 − ), CMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 − ), MEP (Lineage − Flt3 − IL-7R − CD34 − CD16/32 − ), and GMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 + ). Error bars represent mean ± SEM; P -values were determined by Student’s t -test.
Tlr5 Agonist Entolimod Cblb502, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/cblb502/pmc08478872-167-1-14
Average 90 stars, based on 1 article reviews
tlr5 agonist entolimod cblb502 - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
Cleveland Biolabs entolimod-reactive mouse monoclonal antibodies mab4d11 mab11d04
Experimental layouts to determine the role of Nϕ in the A radioprotective and E radiomitigative effects of <t>entolimod</t> in BALB/c mice. Survival by Kaplan–Meier curves in mice treated with entolimod in the presence (rat IgG) or absence (α-Ly-6G) of Nϕ in the B radioprotective and F radiomitigative schemes. P -values were determined by Log-rank test. Measurement of total HPPs and granulocyte/macrophage (G/M) progenitors in BM by MethoCult in the C radioprotective ( n = 4–5 mice /group) and G radiomitigative ( n = 3–10 mice/group) schemes. Total HPPs were measured +1 h post-TBI for radioprotection and for radiomitigation, both total HPPs and G/M progenitors +3d post-treatment with vehicle or entolimod. D Absolute number of stem cell populations in BM by flow cytometry in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ on day 8 post-TBI in the radioprotection scheme ( n = 3–5 mice/group). Stem cell populations were defined as follows: HSC (Lineage − Flt3 − c-kit + Sca-1 + ), MMP (Lineage − Flt3 + c-kit + Sca-1 + ), CLP (Lineage − Flt3 − IL-7R + c-kit + Sca-1 + ), Myeloid (Lineage − Flt3 − IL-7R − c-kit − Sca-1 − ), CMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 − ), MEP (Lineage − Flt3 − IL-7R − CD34 − CD16/32 − ), and GMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 + ). Error bars represent mean ± SEM; P -values were determined by Student’s t -test.
Entolimod Reactive Mouse Monoclonal Antibodies Mab4d11 Mab11d04, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/entolimod+reactive+mouse+monoclonal+antibodies+mab4d11+mab11d04/pmc08041767__42003_2021_1978_MOESM5_ESM-13-35-36
Average 90 stars, based on 1 article reviews
entolimod-reactive mouse monoclonal antibodies mab4d11 mab11d04 - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
Cleveland Biolabs normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies
Experimental layouts to determine the role of Nϕ in the A radioprotective and E radiomitigative effects of <t>entolimod</t> in BALB/c mice. Survival by Kaplan–Meier curves in mice treated with entolimod in the presence (rat IgG) or absence (α-Ly-6G) of Nϕ in the B radioprotective and F radiomitigative schemes. P -values were determined by Log-rank test. Measurement of total HPPs and granulocyte/macrophage (G/M) progenitors in BM by MethoCult in the C radioprotective ( n = 4–5 mice /group) and G radiomitigative ( n = 3–10 mice/group) schemes. Total HPPs were measured +1 h post-TBI for radioprotection and for radiomitigation, both total HPPs and G/M progenitors +3d post-treatment with vehicle or entolimod. D Absolute number of stem cell populations in BM by flow cytometry in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ on day 8 post-TBI in the radioprotection scheme ( n = 3–5 mice/group). Stem cell populations were defined as follows: HSC (Lineage − Flt3 − c-kit + Sca-1 + ), MMP (Lineage − Flt3 + c-kit + Sca-1 + ), CLP (Lineage − Flt3 − IL-7R + c-kit + Sca-1 + ), Myeloid (Lineage − Flt3 − IL-7R − c-kit − Sca-1 − ), CMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 − ), MEP (Lineage − Flt3 − IL-7R − CD34 − CD16/32 − ), and GMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 + ). Error bars represent mean ± SEM; P -values were determined by Student’s t -test.
Normal Human Serum Samples With Very Low Levels Of Entolimod Reactive Neutralizing Antibodies, supplied by Cleveland Biolabs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/entolimod/normal+human+serum+samples+with+very+low+levels+of+entolimod+reactive+neutralizing+antibodies/pmc08041767__42003_2021_1978_MOESM5_ESM-13-48-60
Average 90 stars, based on 1 article reviews
normal human serum samples with very low levels of entolimod-reactive neutralizing antibodies - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

Image Search Results


Experimental layouts to determine the role of Nϕ in the A radioprotective and E radiomitigative effects of entolimod in BALB/c mice. Survival by Kaplan–Meier curves in mice treated with entolimod in the presence (rat IgG) or absence (α-Ly-6G) of Nϕ in the B radioprotective and F radiomitigative schemes. P -values were determined by Log-rank test. Measurement of total HPPs and granulocyte/macrophage (G/M) progenitors in BM by MethoCult in the C radioprotective ( n = 4–5 mice /group) and G radiomitigative ( n = 3–10 mice/group) schemes. Total HPPs were measured +1 h post-TBI for radioprotection and for radiomitigation, both total HPPs and G/M progenitors +3d post-treatment with vehicle or entolimod. D Absolute number of stem cell populations in BM by flow cytometry in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ on day 8 post-TBI in the radioprotection scheme ( n = 3–5 mice/group). Stem cell populations were defined as follows: HSC (Lineage − Flt3 − c-kit + Sca-1 + ), MMP (Lineage − Flt3 + c-kit + Sca-1 + ), CLP (Lineage − Flt3 − IL-7R + c-kit + Sca-1 + ), Myeloid (Lineage − Flt3 − IL-7R − c-kit − Sca-1 − ), CMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 − ), MEP (Lineage − Flt3 − IL-7R − CD34 − CD16/32 − ), and GMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 + ). Error bars represent mean ± SEM; P -values were determined by Student’s t -test.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: Experimental layouts to determine the role of Nϕ in the A radioprotective and E radiomitigative effects of entolimod in BALB/c mice. Survival by Kaplan–Meier curves in mice treated with entolimod in the presence (rat IgG) or absence (α-Ly-6G) of Nϕ in the B radioprotective and F radiomitigative schemes. P -values were determined by Log-rank test. Measurement of total HPPs and granulocyte/macrophage (G/M) progenitors in BM by MethoCult in the C radioprotective ( n = 4–5 mice /group) and G radiomitigative ( n = 3–10 mice/group) schemes. Total HPPs were measured +1 h post-TBI for radioprotection and for radiomitigation, both total HPPs and G/M progenitors +3d post-treatment with vehicle or entolimod. D Absolute number of stem cell populations in BM by flow cytometry in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ on day 8 post-TBI in the radioprotection scheme ( n = 3–5 mice/group). Stem cell populations were defined as follows: HSC (Lineage − Flt3 − c-kit + Sca-1 + ), MMP (Lineage − Flt3 + c-kit + Sca-1 + ), CLP (Lineage − Flt3 − IL-7R + c-kit + Sca-1 + ), Myeloid (Lineage − Flt3 − IL-7R − c-kit − Sca-1 − ), CMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 − ), MEP (Lineage − Flt3 − IL-7R − CD34 − CD16/32 − ), and GMP (Lineage − Flt3 − IL-7R − CD34 + CD16/32 + ). Error bars represent mean ± SEM; P -values were determined by Student’s t -test.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: Flow Cytometry

A Fold change in the Nϕ response in the indicated organs calculated from the absolute number of Nϕ in entolimod-treated (2 h and 5 h) versus vehicle-treated mice ( n = 3–5 mice /group). Flow cytometry was used to identify Nϕ (CD45 + CD11b + Ly-6C + Ly-6G hi ). B Absolute number of endogenous and adoptively transferred Nϕ in the BM, liver, and lungs 2 h post-treatment with vehicle or entolimod ( n = 6–8 mice/group). Adoptive transfers were done by i.v. injection of GFP-expressing BM immediately before treatment. Endogenous versus transferred Nϕ were distinguished by flow cytometry for GFP among the total Nϕ population (CD45 + CD11b + Ly-6C + Ly-6G hi ). C Absolute number (left) and composition (right) of Nϕ populations in the bone marrow at the indicated time points post-treatment by flow cytometry as defined by: pre-Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 + ), immature Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 − CXCR2 − Ly-6G + ), and mature Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 − CXCR2 + Ly-6G + ) where lineage was defined as CD3 − and B220 − ( n = 3–9 mice/group). D Flow cytometry-based staining for TLR5 using biotinylated-entolimod plus streptavidin fluorochrome “sandwich” platform on Nϕ (CD45 + CD11b + Ly-6C + Ly-6G hi ), NK cells (CD45 + CD3ε − NKp46 + ), DCs (CD45 + Ly-6G − B220 − F4/80 − CD11c + ), monocytes (CD45 + Ly-6G − B220 − CD11c − F4/80 + ), B cells (CD45 + Ly-6G − CD11c − F4/80 − B220 + ), CD8 + T cells (CD45 + CD3ε + CD8 + ), CD4 + T cells (CD45 + CD3ε + CD4 + ), platelets (CD45 − CD41 + ), and RBCs (CD45 − Ter119 + ) in the blood of BALB/c and Tlr5 −/− mice. Error bars represent mean ± SEM. * P < 0.04; P -values were determined by Student’s t -test.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: A Fold change in the Nϕ response in the indicated organs calculated from the absolute number of Nϕ in entolimod-treated (2 h and 5 h) versus vehicle-treated mice ( n = 3–5 mice /group). Flow cytometry was used to identify Nϕ (CD45 + CD11b + Ly-6C + Ly-6G hi ). B Absolute number of endogenous and adoptively transferred Nϕ in the BM, liver, and lungs 2 h post-treatment with vehicle or entolimod ( n = 6–8 mice/group). Adoptive transfers were done by i.v. injection of GFP-expressing BM immediately before treatment. Endogenous versus transferred Nϕ were distinguished by flow cytometry for GFP among the total Nϕ population (CD45 + CD11b + Ly-6C + Ly-6G hi ). C Absolute number (left) and composition (right) of Nϕ populations in the bone marrow at the indicated time points post-treatment by flow cytometry as defined by: pre-Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 + ), immature Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 − CXCR2 − Ly-6G + ), and mature Nϕ (Lineage − c-kit int CD115 − CD11b + Gr-1 + CXCR4 − CXCR2 + Ly-6G + ) where lineage was defined as CD3 − and B220 − ( n = 3–9 mice/group). D Flow cytometry-based staining for TLR5 using biotinylated-entolimod plus streptavidin fluorochrome “sandwich” platform on Nϕ (CD45 + CD11b + Ly-6C + Ly-6G hi ), NK cells (CD45 + CD3ε − NKp46 + ), DCs (CD45 + Ly-6G − B220 − F4/80 − CD11c + ), monocytes (CD45 + Ly-6G − B220 − CD11c − F4/80 + ), B cells (CD45 + Ly-6G − CD11c − F4/80 − B220 + ), CD8 + T cells (CD45 + CD3ε + CD8 + ), CD4 + T cells (CD45 + CD3ε + CD4 + ), platelets (CD45 − CD41 + ), and RBCs (CD45 − Ter119 + ) in the blood of BALB/c and Tlr5 −/− mice. Error bars represent mean ± SEM. * P < 0.04; P -values were determined by Student’s t -test.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: Flow Cytometry, Injection, Expressing, Hi-C, Staining

Tlr5 −/− bone marrow chimeric mice received an adoptive transfer of either Tlr5 WT/WT or Tlr5 −/− Nϕ (10 million /mouse) followed immediately by vehicle or entolimod 24 h post-TBI. A , B Survival was measured by Kaplan–Meier curves. P -values were determined by Log-rank test; n = 10–16 mice/group. C Measurement of total HPPs by MethoCult in BM on day 7 post-treatment using the same experimental setup as A . Error bars represent mean ± SEM; P -values were determined by Student’s t -test; n = 4–7 mice/group. In all instances, Nϕ purity was routinely >98%.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: Tlr5 −/− bone marrow chimeric mice received an adoptive transfer of either Tlr5 WT/WT or Tlr5 −/− Nϕ (10 million /mouse) followed immediately by vehicle or entolimod 24 h post-TBI. A , B Survival was measured by Kaplan–Meier curves. P -values were determined by Log-rank test; n = 10–16 mice/group. C Measurement of total HPPs by MethoCult in BM on day 7 post-treatment using the same experimental setup as A . Error bars represent mean ± SEM; P -values were determined by Student’s t -test; n = 4–7 mice/group. In all instances, Nϕ purity was routinely >98%.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: Adoptive Transfer Assay

Protein microarray analysis of A mouse serum using R&D Systems Proteome Profiler Mouse XL Cytokine Array in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ 24 h post-TBI and B Nϕ isolated from BM that were ex vivo treated with vehicle or entolimod for 30 min. Measurement by ELISA of MMP-9 in C serum from mice ( n = 5/group) in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ 2 h post-treatment with vehicle or entolimod (TBI was delivered 24 h prior to vehicle or entolimod) and D supernatants from Tlr5 WT/WT and Tlr5 −/− Nϕ isolated from BM ( n = 6 mice/group) and ex vivo treated with vehicle or entolimod for 30 min.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: Protein microarray analysis of A mouse serum using R&D Systems Proteome Profiler Mouse XL Cytokine Array in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ 24 h post-TBI and B Nϕ isolated from BM that were ex vivo treated with vehicle or entolimod for 30 min. Measurement by ELISA of MMP-9 in C serum from mice ( n = 5/group) in the presence (rat IgG) and absence (α-Ly-6G) of Nϕ 2 h post-treatment with vehicle or entolimod (TBI was delivered 24 h prior to vehicle or entolimod) and D supernatants from Tlr5 WT/WT and Tlr5 −/− Nϕ isolated from BM ( n = 6 mice/group) and ex vivo treated with vehicle or entolimod for 30 min.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: Microarray, Isolation, Ex Vivo, Enzyme-linked Immunosorbent Assay

A BALB/c mice ( n = 5/group) were given 5 Gy TBI followed 24 h later by treatment with vehicle, entolimod, or the indicated doses of recombinant pro-MMP-9 (rMMP-9). Measurement of total HPPs in BM by MethoCult was done on day 3 post-treatment. B Survival by Kaplan–Meier curve in BALB/c mice treated with vehicle, entolimod, or 10 μg/kg rMMP-9 24 h post 7.5 Gy TBI ( n = 9–10 mice /group). P -values were determined by the Log-rank test. C BALB/c mice ( n = 5/group) were given 5 Gy TBI followed 6 h later by rat IgG or α-Ly-6G. Twenty-four hours later mice were treated with vehicle, entolimod, rMMP-9 (10 μg/kg), or rMMP-9 plus entolimod. Measurement of total HPPs in BM by MethoCult was done on day 3 post-treatment. For A and C error bars represent mean ± SEM; P -values were determined by Student’s t -test.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: A BALB/c mice ( n = 5/group) were given 5 Gy TBI followed 24 h later by treatment with vehicle, entolimod, or the indicated doses of recombinant pro-MMP-9 (rMMP-9). Measurement of total HPPs in BM by MethoCult was done on day 3 post-treatment. B Survival by Kaplan–Meier curve in BALB/c mice treated with vehicle, entolimod, or 10 μg/kg rMMP-9 24 h post 7.5 Gy TBI ( n = 9–10 mice /group). P -values were determined by the Log-rank test. C BALB/c mice ( n = 5/group) were given 5 Gy TBI followed 6 h later by rat IgG or α-Ly-6G. Twenty-four hours later mice were treated with vehicle, entolimod, rMMP-9 (10 μg/kg), or rMMP-9 plus entolimod. Measurement of total HPPs in BM by MethoCult was done on day 3 post-treatment. For A and C error bars represent mean ± SEM; P -values were determined by Student’s t -test.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: Recombinant

Following lethal radiation damage, entolimod stimulates Nϕ to release MMP-9 which, in cooperation with G-CSF, accelerates the recovery of hematopoiesis.

Journal: Cell Death Discovery

Article Title: Signaling through TLR5 mitigates lethal radiation damage by neutrophil-dependent release of MMP-9

doi: 10.1038/s41420-021-00642-6

Figure Lengend Snippet: Following lethal radiation damage, entolimod stimulates Nϕ to release MMP-9 which, in cooperation with G-CSF, accelerates the recovery of hematopoiesis.

Article Snippet: The TLR5 agonist entolimod (CBLB502) is a cGMP-manufactured drug product that was obtained from Cleveland BioLabs, Inc. [ ].

Techniques: